Lineage for d2jj2m2 (2jj2 M:82-357)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364615Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1364726Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 1364729Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. 1364753Domain d2jj2m2: 2jj2 M:82-357 [198173]
    Other proteins in same PDB: d2jj2d1, d2jj2d3, d2jj2e1, d2jj2e3, d2jj2f1, d2jj2f3, d2jj2g_, d2jj2k1, d2jj2k3, d2jj2l1, d2jj2l3, d2jj2m1, d2jj2m3, d2jj2n_
    automated match to d1w0jd3
    complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2m2

PDB Entry: 2jj2 (more details), 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.
PDB Compounds: (M:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj2m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj2m2 c.37.1.11 (M:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d2jj2m2:

Click to download the PDB-style file with coordinates for d2jj2m2.
(The format of our PDB-style files is described here.)

Timeline for d2jj2m2: