SCOPe 2.05: Domain d2jj2k3: 2jj2 K:358-475

Lineage for d2jj2k3 (2jj2 K:358-475)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
   Uniprot P00829

8. Domain d2jj2k3: 2jj2 K:358-475 [198168]
   Other proteins in same PDB: d2jj2a1, d2jj2a2, d2jj2a3, d2jj2b1, d2jj2b2, d2jj2b3, d2jj2c1, d2jj2c2, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2e1, d2jj2e2, d2jj2f1, d2jj2f2, d2jj2g_, d2jj2h1, d2jj2h2, d2jj2h3, d2jj2i1, d2jj2i2, d2jj2i3, d2jj2j1, d2jj2j2, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2l1, d2jj2l2, d2jj2m1, d2jj2m2, d2jj2n_
   automated match to d1e79d1
   complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2k3

PDB Entry: 2jj2, 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.

PDB Compounds: (K:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj2k3:

Sequence; same for both SEQRES and ATOM records:

>d2jj2k3 a.69.1.1 (K:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

Timeline for d2jj2k3:

• d2jj2k3 first appeared in SCOPe 2.03
  
• d2jj2k3 appears in SCOPe 2.04
  
• d2jj2k3 appears in SCOPe 2.06
  
• d2jj2k3 appears in the current release, SCOPe 2.08