Lineage for d2igfl1 (2igf L:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287841Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)
  8. 287951Domain d2igfl1: 2igf L:1-107 [19816]
    Other proteins in same PDB: d2igfh1, d2igfh2, d2igfl2
    part of Fab B13I2
    complexed with nag

Details for d2igfl1

PDB Entry: 2igf (more details), 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
PDB Compounds: (L:)

SCOP Domain Sequences for d2igfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igfl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

SCOP Domain Coordinates for d2igfl1:

Click to download the PDB-style file with coordinates for d2igfl1.
(The format of our PDB-style files is described here.)

Timeline for d2igfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2igfl2