Lineage for d2jj2d1 (2jj2 D:9-81)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320662Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1320663Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
    automatically mapped to Pfam PF02874
  5. 1320664Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1320720Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 1320723Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 1320742Domain d2jj2d1: 2jj2 D:9-81 [198157]
    Other proteins in same PDB: d2jj2d2, d2jj2d3, d2jj2e2, d2jj2e3, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2k2, d2jj2k3, d2jj2l2, d2jj2l3, d2jj2m2, d2jj2m3, d2jj2n_
    automated match to d1e79d2
    complexed with adp, anp, azi, gol, mg, po4, que

Details for d2jj2d1

PDB Entry: 2jj2 (more details), 2.4 Å

PDB Description: the structure of f1-atpase inhibited by quercetin.
PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj2d1 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d2jj2d1:

Click to download the PDB-style file with coordinates for d2jj2d1.
(The format of our PDB-style files is described here.)

Timeline for d2jj2d1: