| Class b: All beta proteins [48724] (174 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() automatically mapped to Pfam PF02874 |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries) Uniprot P00829 |
| Domain d2jj1f1: 2jj1 F:9-81 [198145] Other proteins in same PDB: d2jj1d2, d2jj1d3, d2jj1e2, d2jj1e3, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1k2, d2jj1k3, d2jj1l2, d2jj1l3, d2jj1m2, d2jj1m3, d2jj1n_ automated match to d1w0jd2 complexed with adp, anp, azi, gol, mg, pit, po4 |
PDB Entry: 2jj1 (more details), 2.7 Å
SCOPe Domain Sequences for d2jj1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj1f1 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap
Timeline for d2jj1f1: