SCOPe 2.08: Domain d2jj0h2: 2jj0 H:36-245

Lineage for d2jj0h2 (2jj0 H:36-245)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d2jj0h2: 2jj0 H:36-245 [198138]
   Other proteins in same PDB: d2jj0h1, d2jj0l_, d2jj0m_
   automated match to d1qovh1
   complexed with bcl, bph, cdl, cl, fe, spn, u10; mutant

Details for d2jj0h2

PDB Entry: 2jj0, 2.8 Å

PDB Description: photosynthetic reaction center mutant with ala m248 replaced with trp (chain m, am248w)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2jj0h2:

Sequence; same for both SEQRES and ATOM records:

>d2jj0h2 b.41.1.1 (H:36-245) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaa

Timeline for d2jj0h2:

• d2jj0h2 first appeared in SCOPe 2.03
  
• d2jj0h2 appears in SCOPe 2.07