Lineage for d2jizm3 (2jiz M:358-474)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717430Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 2717442Domain d2jizm3: 2jiz M:358-474 [198136]
    Other proteins in same PDB: d2jiza1, d2jiza2, d2jiza3, d2jizb1, d2jizb2, d2jizb3, d2jizc1, d2jizc2, d2jizc3, d2jizd1, d2jizd2, d2jize1, d2jize2, d2jizf1, d2jizf2, d2jizg_, d2jizh1, d2jizh2, d2jizh3, d2jizi1, d2jizi2, d2jizi3, d2jizj1, d2jizj2, d2jizj3, d2jizk1, d2jizk2, d2jizl1, d2jizl2, d2jizm1, d2jizm2, d2jizn_
    automated match to d1w0jd1
    complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jizm3

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (M:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jizm3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jizm3 a.69.1.1 (M:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d2jizm3:

Click to download the PDB-style file with coordinates for d2jizm3.
(The format of our PDB-style files is described here.)

Timeline for d2jizm3: