Lineage for d2jizm2 (2jiz M:82-357)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364615Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1364726Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 1364729Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. 1364744Domain d2jizm2: 2jiz M:82-357 [198135]
    Other proteins in same PDB: d2jizd1, d2jizd3, d2jize1, d2jize3, d2jizf1, d2jizf3, d2jizg_, d2jizk1, d2jizk3, d2jizl1, d2jizl3, d2jizm1, d2jizm3, d2jizn_
    automated match to d1w0jd3
    complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jizm2

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (M:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jizm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jizm2 c.37.1.11 (M:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d2jizm2:

Click to download the PDB-style file with coordinates for d2jizm2.
(The format of our PDB-style files is described here.)

Timeline for d2jizm2: