SCOP 1.69: Domain d1igfh1: 1igf H:1-113

Lineage for d1igfh1 (1igf H:1-113)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)

8. Domain d1igfh1: 1igf H:1-113 [19813]
   Other proteins in same PDB: d1igfh2, d1igfj2, d1igfl1, d1igfl2, d1igfm1, d1igfm2

Details for d1igfh1

PDB Entry: 1igf, 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d1igfh1:

Sequence; same for both SEQRES and ATOM records:

>d1igfh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvss

Timeline for d1igfh1:

• d1igfh1 first appeared (with stable ids) in SCOP 1.55
  
• d1igfh1 appears in SCOP 1.67
  
• d1igfh1 appears in SCOP 1.71
  
• d1igfh1 appears in the current release, SCOPe 2.08