Lineage for d2jizk2 (2jiz K:82-357)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596277Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1596387Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 1596390Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. 1596400Domain d2jizk2: 2jiz K:82-357 [198129]
    Other proteins in same PDB: d2jiza1, d2jiza2, d2jiza3, d2jizb1, d2jizb2, d2jizb3, d2jizc1, d2jizc2, d2jizc3, d2jizd1, d2jizd3, d2jize1, d2jize3, d2jizf1, d2jizf3, d2jizg_, d2jizh1, d2jizh2, d2jizh3, d2jizi1, d2jizi2, d2jizi3, d2jizj1, d2jizj2, d2jizj3, d2jizk1, d2jizk3, d2jizl1, d2jizl3, d2jizm1, d2jizm3, d2jizn_
    automated match to d1e79d3
    complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jizk2

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (K:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jizk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jizk2 c.37.1.11 (K:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d2jizk2:

Click to download the PDB-style file with coordinates for d2jizk2.
(The format of our PDB-style files is described here.)

Timeline for d2jizk2: