SCOPe 2.08: Domain d2jize2: 2jiz E:82-357

Lineage for d2jize2 (2jiz E:82-357)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
   Uniprot P00829

8. Domain d2jize2: 2jiz E:82-357 [198123]
   Other proteins in same PDB: d2jiza1, d2jiza2, d2jiza3, d2jizb1, d2jizb2, d2jizb3, d2jizc1, d2jizc2, d2jizc3, d2jizd1, d2jizd3, d2jize1, d2jize3, d2jizf1, d2jizf3, d2jizg_, d2jizh1, d2jizh2, d2jizh3, d2jizi1, d2jizi2, d2jizi3, d2jizj1, d2jizj2, d2jizj3, d2jizk1, d2jizk3, d2jizl1, d2jizl3, d2jizm1, d2jizm3, d2jizn_
   automated match to d1w0jd3
   complexed with adp, anp, azi, gol, mg, po4, stl

Details for d2jize2

PDB Entry: 2jiz, 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jize2:

Sequence; same for both SEQRES and ATOM records:

>d2jize2 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Timeline for d2jize2:

• d2jize2 first appeared in SCOPe 2.03
  
• d2jize2 appears in SCOPe 2.07