SCOP 1.63: Domain d1igfl1: 1igf L:1-107

Lineage for d1igfl1 (1igf L:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab B13I2 (mouse), kappa L chain [48760] (2 PDB entries)

8. Domain d1igfl1: 1igf L:1-107 [19812]
   Other proteins in same PDB: d1igfh2, d1igfj2, d1igfl2, d1igfm2

Details for d1igfl1

PDB Entry: 1igf, 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d1igfl1:

Sequence; same for both SEQRES and ATOM records:

>d1igfl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab B13I2 (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

Timeline for d1igfl1:

• d1igfl1 first appeared (with stable ids) in SCOP 1.55
  
• d1igfl1 appears in SCOP 1.61
  
• d1igfl1 appears in SCOP 1.65
  
• d1igfl1 appears in the current release, SCOPe 2.08