SCOPe 2.08: Domain d2jerg_: 2jer G:

Lineage for d2jerg_ (2jer G:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein Agmatine iminohydrolase [111156] (3 species)

7. Species Enterococcus faecalis [TaxId:1351] [160717] (1 PDB entry)
   Uniprot Q837U5 2-365

8. Domain d2jerg_: 2jer G: [198115]
   Other proteins in same PDB: d2jerd3
   automated match to d2jera1

Details for d2jerg_

PDB Entry: 2jer, 1.65 Å

PDB Description: agmatine deiminase of enterococcus faecalis catalyzing its reaction.

PDB Compounds: (G:) agmatine deiminase

SCOPe Domain Sequences for d2jerg_:

Sequence; same for both SEQRES and ATOM records:

>d2jerg_ d.126.1.6 (G:) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendrlaleqvqtmfpdkkivgvntvevvygggnihxitqq
epkrvg

Timeline for d2jerg_:

• d2jerg_ first appeared in SCOPe 2.03
  
• d2jerg_ appears in SCOPe 2.07