| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein automated matches [190035] (28 species) not a true protein |
| Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries) |
| Domain d2jecc1: 2jec C:3-239 [198114] Other proteins in same PDB: d2jeca2, d2jecb2, d2jecc2, d2jecd2 automated match to d2jecd_ complexed with ca, mn, xmm; mutant |
PDB Entry: 2jec (more details), 2 Å
SCOPe Domain Sequences for d2jecc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jecc1 b.29.1.1 (C:3-239) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
Timeline for d2jecc1: