Lineage for d2jecc1 (2jec C:3-239)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779057Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries)
  8. 2779060Domain d2jecc1: 2jec C:3-239 [198114]
    Other proteins in same PDB: d2jeca2, d2jecb2, d2jecc2, d2jecd2
    automated match to d2jecd_
    complexed with ca, mn, xmm; mutant

Details for d2jecc1

PDB Entry: 2jec (more details), 2 Å

PDB Description: crystal structure of recombinant dioclea grandiflora lectin mutant e123a-h131n-k132q complexed with 5-bromo-4-chloro-3-indolyl-a-d- mannose
PDB Compounds: (C:) Lectin alpha chain

SCOPe Domain Sequences for d2jecc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jecc1 b.29.1.1 (C:3-239) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2jecc1:

Click to download the PDB-style file with coordinates for d2jecc1.
(The format of our PDB-style files is described here.)

Timeline for d2jecc1: