Lineage for d2jeca_ (2jec A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307626Protein automated matches [190035] (19 species)
    not a true protein
  7. 1307756Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (2 PDB entries)
  8. 1307757Domain d2jeca_: 2jec A: [198112]
    automated match to d2jecd_
    complexed with ca, mn, xmm; mutant

Details for d2jeca_

PDB Entry: 2jec (more details), 2 Å

PDB Description: crystal structure of recombinant dioclea grandiflora lectin mutant e123a-h131n-k132q complexed with 5-bromo-4-chloro-3-indolyl-a-d-mannose
PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d2jeca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeca_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
madtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvak
rlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktns
iadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapv
hiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2jeca_:

Click to download the PDB-style file with coordinates for d2jeca_.
(The format of our PDB-style files is described here.)

Timeline for d2jeca_: