SCOPe 2.03: Domain d2jeca_: 2jec A:

Lineage for d2jeca_ (2jec A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (19 species)
   not a true protein

7. Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (2 PDB entries)

8. Domain d2jeca_: 2jec A: [198112]
   automated match to d2jecd_
   complexed with ca, mn, xmm; mutant

Details for d2jeca_

PDB Entry: 2jec, 2 Å

PDB Description: crystal structure of recombinant dioclea grandiflora lectin mutant e123a-h131n-k132q complexed with 5-bromo-4-chloro-3-indolyl-a-d- mannose

PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d2jeca_:

Sequence; same for both SEQRES and ATOM records:

>d2jeca_ b.29.1.1 (A:) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
madtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvak
rlsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktns
iadanslhfsfnqfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapv
hiweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Timeline for d2jeca_:

• d2jeca_ is new in SCOPe 2.03-stable
  
• d2jeca_ appears in SCOPe 2.04
  
• d2jeca_ appears in the current release, SCOPe 2.08, called d2jeca1