SCOPe 2.08: Domain d2je9c1: 2je9 C:3-239

Lineage for d2je9c1 (2je9 C:3-239)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries)

8. Domain d2je9c1: 2je9 C:3-239 [198111]
   Other proteins in same PDB: d2je9a2, d2je9b2, d2je9c2, d2je9d2
   automated match to d2je9d_
   complexed with ca, mn, so4, xmm

Details for d2je9c1

PDB Entry: 2je9, 2.1 Å

PDB Description: crystal structure of recombinant dioclea grandiflora lectin complexed with 5-bromo-4-chloro-3-indolyl-a-d-mannose

PDB Compounds: (C:) Lectin alpha chain

SCOPe Domain Sequences for d2je9c1:

Sequence; same for both SEQRES and ATOM records:

>d2je9c1 b.29.1.1 (C:3-239) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adenslhfsfhkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Timeline for d2je9c1:

• d2je9c1 first appeared in SCOPe 2.03, called d2je9c_
  
• d2je9c1 appears in SCOPe 2.07