Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries) |
Domain d2je9b1: 2je9 B:3-239 [198110] Other proteins in same PDB: d2je9a2, d2je9b2, d2je9c2, d2je9d2 automated match to d2je9d_ complexed with ca, mn, so4, xmm |
PDB Entry: 2je9 (more details), 2.1 Å
SCOPe Domain Sequences for d2je9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2je9b1 b.29.1.1 (B:3-239) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]} adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi adenslhfsfhkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvh iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
Timeline for d2je9b1: