Lineage for d1dfbh1 (1dfb H:1-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739899Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2739916Domain d1dfbh1: 1dfb H:1-126 [19811]
    Other proteins in same PDB: d1dfbh2, d1dfbl1, d1dfbl2
    part of Fab 3D6

Details for d1dfbh1

PDB Entry: 1dfb (more details), 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i
PDB Compounds: (H:) igg1-kappa 3d6 fab (heavy chain)

SCOPe Domain Sequences for d1dfbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvqpgrslrlscaasgftfndyamhwvrqapgkglewvsgiswdsssigy
adsvkgrftisrdnaknslylqmnslraedmalyycvkgrdyydsggyftvafdiwgqgt
mvtvss

SCOPe Domain Coordinates for d1dfbh1:

Click to download the PDB-style file with coordinates for d1dfbh1.
(The format of our PDB-style files is described here.)

Timeline for d1dfbh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfbh2