![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Mucana (Dioclea grandiflora) [TaxId:3837] [188247] (3 PDB entries) |
![]() | Domain d2je9a1: 2je9 A:3-239 [198109] Other proteins in same PDB: d2je9a2, d2je9b2, d2je9c2, d2je9d2 automated match to d2je9d_ complexed with ca, mn, so4, xmm |
PDB Entry: 2je9 (more details), 2.1 Å
SCOPe Domain Sequences for d2je9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2je9a1 b.29.1.1 (A:3-239) automated matches {Mucana (Dioclea grandiflora) [TaxId: 3837]} adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi adenslhfsfhkfsqnpkdlilqgdaftdsdgnlqltkvsssgdpqgnsvgralfyapvh iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
Timeline for d2je9a1: