Lineage for d2jb6l1 (2jb6 L:4-112)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520138Domain d2jb6l1: 2jb6 L:4-112 [198104]
    Other proteins in same PDB: d2jb6a2, d2jb6b1, d2jb6b2, d2jb6h1, d2jb6h2, d2jb6l2
    automated match to d1lgva1
    complexed with t5c

Details for d2jb6l1

PDB Entry: 2jb6 (more details), 2.85 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-2
PDB Compounds: (L:) fab fragment mor03268 light chain

SCOPe Domain Sequences for d2jb6l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jb6l1 b.1.1.0 (L:4-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgvsnr
fsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlg

SCOPe Domain Coordinates for d2jb6l1:

Click to download the PDB-style file with coordinates for d2jb6l1.
(The format of our PDB-style files is described here.)

Timeline for d2jb6l1: