Lineage for d2jb6a1 (2jb6 A:3-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367849Domain d2jb6a1: 2jb6 A:3-112 [198102]
    Other proteins in same PDB: d2jb6a2, d2jb6b1, d2jb6b2, d2jb6h1, d2jb6h2, d2jb6l2
    automated match to d1lgva1
    complexed with t5c

Details for d2jb6a1

PDB Entry: 2jb6 (more details), 2.85 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-2
PDB Compounds: (A:) fab fragment mor03268 light chain

SCOPe Domain Sequences for d2jb6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jb6a1 b.1.1.0 (A:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdvgsnnyvswyqqhpgkapklmiyggsnrpsgvsn
rfsgsksgntasltisglqaedeadyycrswdsnlsysvfgggtkltvlg

SCOPe Domain Coordinates for d2jb6a1:

Click to download the PDB-style file with coordinates for d2jb6a1.
(The format of our PDB-style files is described here.)

Timeline for d2jb6a1: