Lineage for d1dfbl1 (1dfb L:1-106)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782719Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)
  8. 782752Domain d1dfbl1: 1dfb L:1-106 [19810]
    Other proteins in same PDB: d1dfbh1, d1dfbh2, d1dfbl2
    part of Fab 3D6

Details for d1dfbl1

PDB Entry: 1dfb (more details), 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i
PDB Compounds: (L:) igg1-kappa 3d6 fab (light chain)

SCOP Domain Sequences for d1dfbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfbl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcrasqsisrwlawyqqkpgkvpklliykasslesgvps
rfsgsgsgteftltisslqpddfatyycqqynsysfgpgtkvdikr

SCOP Domain Coordinates for d1dfbl1:

Click to download the PDB-style file with coordinates for d1dfbl1.
(The format of our PDB-style files is described here.)

Timeline for d1dfbl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfbl2