| Class b: All beta proteins [48724] (176 folds) |
| Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
| Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
| Protein Photosynthetic reaction centre [50348] (3 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries) Uniprot P11846 |
| Domain d2j8dh2: 2j8d H:36-260 [198095] Other proteins in same PDB: d2j8dh1, d2j8dl_, d2j8dm_ automated match to d1ysth1 complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10 |
PDB Entry: 2j8d (more details), 2.07 Å
SCOPe Domain Sequences for d2j8dh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8dh2 b.41.1.1 (H:36-260) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlaeya
Timeline for d2j8dh2: