Lineage for d2j8dh2 (2j8d H:36-260)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791427Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2791428Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2791429Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2791430Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2791431Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
    Uniprot P11846
  8. 2791453Domain d2j8dh2: 2j8d H:36-260 [198095]
    Other proteins in same PDB: d2j8dh1, d2j8dl_, d2j8dm_
    automated match to d1ysth1
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10

Details for d2j8dh2

PDB Entry: 2j8d (more details), 2.07 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 8 in the charge-separated state
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2j8dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8dh2 b.41.1.1 (H:36-260) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlaeya

SCOPe Domain Coordinates for d2j8dh2:

Click to download the PDB-style file with coordinates for d2j8dh2.
(The format of our PDB-style files is described here.)

Timeline for d2j8dh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j8dh1