Lineage for d2j8dh1 (2j8d H:1-35)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254169Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2254170Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 2254171Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 2254172Species Rhodobacter sphaeroides [TaxId:1063] [81486] (84 PDB entries)
    Uniprot P11846
  8. 2254179Domain d2j8dh1: 2j8d H:1-35 [198094]
    Other proteins in same PDB: d2j8dh2, d2j8dl_, d2j8dm_
    automated match to d1ysth2
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10

Details for d2j8dh1

PDB Entry: 2j8d (more details), 2.07 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 8 in the charge-separated state
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2j8dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8dh1 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]}
mvgvtafgnfdlaslaiysfwiflagliyylqten

SCOPe Domain Coordinates for d2j8dh1:

Click to download the PDB-style file with coordinates for d2j8dh1.
(The format of our PDB-style files is described here.)

Timeline for d2j8dh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j8dh2