Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein automated matches [190637] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (2 PDB entries) |
Domain d2j3pa_: 2j3p A: [198089] automated match to d2j3pb_ complexed with so4 |
PDB Entry: 2j3p (more details), 1.4 Å
SCOPe Domain Sequences for d2j3pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j3pa_ b.42.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqyla mdtegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthyg qkailflplpvssd
Timeline for d2j3pa_: