Lineage for d2j20a_ (2j20 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300967Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 1300968Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1301058Protein automated matches [190198] (2 species)
    not a true protein
  7. 1301059Species Human (Homo sapiens) [TaxId:9606] [186941] (37 PDB entries)
  8. 1301098Domain d2j20a_: 2j20 A: [198087]
    automated match to d2j20b_
    complexed with so4, zn; mutant

Details for d2j20a_

PDB Entry: 2j20 (more details), 1.8 Å

PDB Description: human p53 core domain mutant m133l-v203a-n239y-n268d-r273c
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2j20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j20a_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevcvc
acpgrdrrteeenlr

SCOPe Domain Coordinates for d2j20a_:

Click to download the PDB-style file with coordinates for d2j20a_.
(The format of our PDB-style files is described here.)

Timeline for d2j20a_: