SCOPe 2.07: Domain d2j1za_: 2j1z A:

Lineage for d2j1za_ (2j1z A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d2j1za_: 2j1z A: [198086]
   automated match to d2j1zb_
   complexed with zn; mutant

Details for d2j1za_

PDB Entry: 2j1z, 1.8 Å

PDB Description: human p53 core domain mutant m133l-v203a-n239y-n268d-f270l

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2j1za_:

Sequence; same for both SEQRES and ATOM records:

>d2j1za_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdslevrvc
acpgrdrrteeenlr

Timeline for d2j1za_:

• d2j1za_ first appeared in SCOPe 2.03
  
• d2j1za_ appears in SCOPe 2.06
  
• d2j1za_ appears in the current release, SCOPe 2.08