| Class b: All beta proteins [48724] (178 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
| Protein automated matches [190198] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries) |
| Domain d2j1wa_: 2j1w A: [198085] automated match to d2j1wb_ complexed with zn; mutant |
PDB Entry: 2j1w (more details), 1.8 Å
SCOPe Domain Sequences for d2j1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1wa_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpaqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlr
Timeline for d2j1wa_: