Lineage for d2j1ta_ (2j1t A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2385107Species Streptococcus pneumoniae [TaxId:170187] [193202] (6 PDB entries)
  8. 2385114Domain d2j1ta_: 2j1t A: [198084]
    automated match to d2j1tb_
    complexed with ca, fuc

Details for d2j1ta_

PDB Entry: 2j1t (more details), 1.6 Å

PDB Description: structure of a streptococcus pneumoniae fucose binding module in complex with the lewis y antigen
PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2j1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1ta_ b.18.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
gnlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkv
glvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkl
ltsgvplslaevevfr

SCOPe Domain Coordinates for d2j1ta_:

Click to download the PDB-style file with coordinates for d2j1ta_.
(The format of our PDB-style files is described here.)

Timeline for d2j1ta_: