| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
| Domain d2j05a1: 2j05 A:281-341 [198083] Other proteins in same PDB: d2j05a2 automated match to d2j05b_ |
PDB Entry: 2j05 (more details), 1.5 Å
SCOPe Domain Sequences for d2j05a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j05a1 b.34.2.0 (A:281-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlveevg
r
Timeline for d2j05a1: