Lineage for d2dbll1 (2dbl L:1-107)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547441Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 547588Domain d2dbll1: 2dbl L:1-107 [19808]
    Other proteins in same PDB: d2dblh1, d2dblh2, d2dbll2
    part of Fab DB3
    complexed with s5h

Details for d2dbll1

PDB Entry: 2dbl (more details), 2.9 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d2dbll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbll1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleik

SCOP Domain Coordinates for d2dbll1:

Click to download the PDB-style file with coordinates for d2dbll1.
(The format of our PDB-style files is described here.)

Timeline for d2dbll1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dbll2