Lineage for d2dbll1 (2dbl L:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158153Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)
  8. 158165Domain d2dbll1: 2dbl L:1-107 [19808]
    Other proteins in same PDB: d2dblh2, d2dbll2

Details for d2dbll1

PDB Entry: 2dbl (more details), 2.9 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d2dbll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbll1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleik

SCOP Domain Coordinates for d2dbll1:

Click to download the PDB-style file with coordinates for d2dbll1.
(The format of our PDB-style files is described here.)

Timeline for d2dbll1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dbll2