Lineage for d2ihud2 (2ihu D:198-374)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360793Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1360794Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1360823Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1360877Protein Carboxyethylarginine synthase [102290] (1 species)
  7. 1360878Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries)
  8. 1360886Domain d2ihud2: 2ihu D:198-374 [198072]
    Other proteins in same PDB: d2ihua2, d2ihua3, d2ihub1, d2ihub3, d2ihuc1, d2ihuc3, d2ihud1, d2ihud3
    automated match to d1upaa1
    complexed with gol, k, mg, tar, tp8, tp9

Details for d2ihud2

PDB Entry: 2ihu (more details), 2.05 Å

PDB Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: putative reaction intermediate complex
PDB Compounds: (D:) carboxyethylarginine synthase

SCOPe Domain Sequences for d2ihud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihud2 c.31.1.3 (D:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl
pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr
isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad

SCOPe Domain Coordinates for d2ihud2:

Click to download the PDB-style file with coordinates for d2ihud2.
(The format of our PDB-style files is described here.)

Timeline for d2ihud2: