![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
![]() | Protein Carboxyethylarginine synthase [102330] (1 species) |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries) |
![]() | Domain d2ihud1: 2ihu D:11-197 [198071] Other proteins in same PDB: d2ihua1, d2ihua3, d2ihub2, d2ihub3, d2ihuc2, d2ihuc3, d2ihud2, d2ihud3 automated match to d1upaa2 complexed with gol, k, mg, tar, tp8, tp9 |
PDB Entry: 2ihu (more details), 2.05 Å
SCOPe Domain Sequences for d2ihud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihud1 c.36.1.5 (D:11-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant pakpvgv
Timeline for d2ihud1: