Lineage for d2ihub1 (2ihu B:11-197)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592645Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1592693Protein Carboxyethylarginine synthase [102330] (1 species)
  7. 1592694Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries)
  8. 1592700Domain d2ihub1: 2ihu B:11-197 [198065]
    Other proteins in same PDB: d2ihua1, d2ihua3, d2ihub2, d2ihub3, d2ihuc2, d2ihuc3, d2ihud2, d2ihud3
    automated match to d1upaa2
    complexed with gol, k, mg, tar, tp8, tp9

Details for d2ihub1

PDB Entry: 2ihu (more details), 2.05 Å

PDB Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: putative reaction intermediate complex
PDB Compounds: (B:) carboxyethylarginine synthase

SCOPe Domain Sequences for d2ihub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihub1 c.36.1.5 (B:11-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant
pakpvgv

SCOPe Domain Coordinates for d2ihub1:

Click to download the PDB-style file with coordinates for d2ihub1.
(The format of our PDB-style files is described here.)

Timeline for d2ihub1: