Lineage for d2iexa_ (2iex A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100162Species Geobacillus kaustophilus [TaxId:235909] [193499] (3 PDB entries)
  8. 2100170Domain d2iexa_: 2iex A: [198063]
    automated match to d2iexc_

Details for d2iexa_

PDB Entry: 2iex (more details), 2.2 Å

PDB Description: Crystal structure of dihydroxynapthoic acid synthetase (GK2873) from Geobacillus kaustophilus HTA426
PDB Compounds: (A:) Dihydroxynapthoic acid synthetase

SCOPe Domain Sequences for d2iexa_:

Sequence, based on SEQRES records: (download)

>d2iexa_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
wvkqydyediiyetyngiakitinrpevhnafrpktvnemidaftkarddsnigviiltg
aggkafcsggdqkvrghggyvgedeiprlnvldlqrlirvipkpviamvagyaiggghvl
hvvcdltiaadnaifgqtgpkvgsfdggygagylarivghkkareiwylcrqytaqeale
mglvnkvvpleqleeetvkwaqeileksptairflkaafnadsdglagiqqlagdatllf
ytteeakegmrafkekrkpdfsqfprfp

Sequence, based on observed residues (ATOM records): (download)

>d2iexa_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
wvkqydyediiyetyngiakitinrpevhnafrpktvnemidaftkarddsnigviiltg
aggkafcsggdprlnvldlqrlirvipkpviamvagyaiggghvlhvvcdltiaadnaif
gqtgpkvgsfdggygagylarivghkkareiwylcrqytaqealemglvnkvvpleqlee
etvkwaqeileksptairflkaafnadsdglagiqqlagdatllfytteeakegmrafke
krkpdfsqfprfp

SCOPe Domain Coordinates for d2iexa_:

Click to download the PDB-style file with coordinates for d2iexa_.
(The format of our PDB-style files is described here.)

Timeline for d2iexa_: