SCOP 1.57: Domain d1dbkl1: 1dbk L:1-107

Lineage for d1dbkl1 (1dbk L:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)

8. Domain d1dbkl1: 1dbk L:1-107 [19806]
   Other proteins in same PDB: d1dbkh2, d1dbkl2

Details for d1dbkl1

PDB Entry: 1dbk, 3 Å

PDB Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity

SCOP Domain Sequences for d1dbkl1:

Sequence; same for both SEQRES and ATOM records:

>d1dbkl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleik

Timeline for d1dbkl1:

• d1dbkl1 first appeared (with stable ids) in SCOP 1.55
  
• d1dbkl1 appears in SCOP 1.59
  
• d1dbkl1 appears in the current release, SCOPe 2.08