| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d2ians2: 2ian S:110-198 [198057] Other proteins in same PDB: d2iana1, d2iana2, d2iana3, d2ianb1, d2ianb2, d2iand1, d2iane1, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2ianj1, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iano1, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2iant1 automated match to d1qrnd2 mutant |
PDB Entry: 2ian (more details), 2.8 Å
SCOPe Domain Sequences for d2ians2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ians2 b.1.1.2 (S:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
Timeline for d2ians2:
View in 3DDomains from other chains: (mouse over for more information) d2iana1, d2iana2, d2iana3, d2ianb1, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2iant1, d2iant2 |