Lineage for d2ianj1 (2ian J:2-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033466Domain d2ianj1: 2ian J:2-112 [198050]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand2, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iang2, d2iani2, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann2, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians2, d2iant2
    automated match to d1qrne1
    mutant

Details for d2ianj1

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (J:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2ianj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ianj1 b.1.1.0 (J:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevp
ngynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvved

SCOPe Domain Coordinates for d2ianj1:

Click to download the PDB-style file with coordinates for d2ianj1.
(The format of our PDB-style files is described here.)

Timeline for d2ianj1: