SCOPe 2.07: Domain d2iamc2: 2iam C:110-198

Lineage for d2iamc2 (2iam C:110-198)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d2iamc2: 2iam C:110-198 [198041]
   Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc1, d2iamd1
   automated match to d1qrnd2
   mutant

Details for d2iamc2

PDB Entry: 2iam, 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr

PDB Compounds: (C:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2iamc2:

Sequence; same for both SEQRES and ATOM records:

>d2iamc2 b.1.1.2 (C:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d2iamc2:

• d2iamc2 first appeared in SCOPe 2.03
  
• d2iamc2 appears in SCOPe 2.06
  
• d2iamc2 appears in the current release, SCOPe 2.08