Lineage for d2iamc1 (2iam C:1-109)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520063Domain d2iamc1: 2iam C:1-109 [198040]
    Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc2, d2iamd2
    automated match to d1qrnd1
    mutant

Details for d2iamc1

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (C:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2iamc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iamc1 b.1.1.0 (C:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpn

SCOPe Domain Coordinates for d2iamc1:

Click to download the PDB-style file with coordinates for d2iamc1.
(The format of our PDB-style files is described here.)

Timeline for d2iamc1: