Lineage for d1dbah1 (1dba H:1-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353425Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 2353457Domain d1dbah1: 1dba H:1-112 [19803]
    Other proteins in same PDB: d1dbah2, d1dbal1, d1dbal2
    part of Fab DB3
    complexed with eoh

Details for d1dbah1

PDB Entry: 1dba (more details), 2.8 Å

PDB Description: three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex
PDB Compounds: (H:) igg1-kappa db3 fab (heavy chain)

SCOPe Domain Sequences for d1dbah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbah1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvs

SCOPe Domain Coordinates for d1dbah1:

Click to download the PDB-style file with coordinates for d1dbah1.
(The format of our PDB-style files is described here.)

Timeline for d1dbah1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbah2