![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries) Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor |
![]() | Domain d2hvja1: 2hvj A:6-118 [198028] Other proteins in same PDB: d2hvja2, d2hvja3, d2hvjb1, d2hvjb2, d2hvjc_ automated match to d1r3jb1 complexed with f09, k, l2c, tba |
PDB Entry: 2hvj (more details), 2.75 Å
SCOPe Domain Sequences for d2hvja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvja1 b.1.1.1 (A:6-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss
Timeline for d2hvja1: