SCOPe 2.03: Domain d2hh1h2: 2hh1 H:36-251

Lineage for d2hh1h2 (2hh1 H:36-251)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
   Uniprot P11846

8. Domain d2hh1h2: 2hh1 H:36-251 [198013]
   Other proteins in same PDB: d2hh1h1, d2hh1l_, d2hh1m_
   automated match to d1l9bh1
   complexed with bcl, bph, cdl, fe, gol, hto, k, lda, pc7, pc9, po4, u10

Details for d2hh1h2

PDB Entry: 2hh1, 2.55 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylcholine

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2hh1h2:

Sequence; same for both SEQRES and ATOM records:

>d2hh1h2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

Timeline for d2hh1h2:

• d2hh1h2 is new in SCOPe 2.03-stable
  
• d2hh1h2 appears in SCOPe 2.04
  
• d2hh1h2 appears in the current release, SCOPe 2.08