Lineage for d2hfgl1 (2hfg L:1-106A)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765827Domain d2hfgl1: 2hfg L:1-106A [198006]
    Other proteins in same PDB: d2hfgh1, d2hfgh2, d2hfgl2, d2hfgr_
    automated match to d1rhha1

Details for d2hfgl1

PDB Entry: 2hfg (more details), 2.61 Å

PDB Description: Crystal structure of hBR3 bound to CB3s-Fab
PDB Compounds: (L:) CB3s Fab light chain (kappa)

SCOPe Domain Sequences for d2hfgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfgl1 b.1.1.0 (L:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsqispptfgqgtkveik

SCOPe Domain Coordinates for d2hfgl1:

Click to download the PDB-style file with coordinates for d2hfgl1.
(The format of our PDB-style files is described here.)

Timeline for d2hfgl1: