![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
![]() | Domain d2hffa2: 2hff A:107-213 [198003] Other proteins in same PDB: d2hffa1, d2hffb1, d2hffb2, d2hffh1, d2hffh2, d2hffl1 automated match to d1rhha2 |
PDB Entry: 2hff (more details), 1.95 Å
SCOPe Domain Sequences for d2hffa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hffa2 b.1.1.2 (A:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d2hffa2: