Lineage for d2he9a1 (2he9 A:7-177)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2397680Protein automated matches [190077] (18 species)
    not a true protein
  7. 2397702Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)
  8. 2397712Domain d2he9a1: 2he9 A:7-177 [198001]
    Other proteins in same PDB: d2he9a2, d2he9b2
    automated match to d2he9b_
    complexed with so4

Details for d2he9a1

PDB Entry: 2he9 (more details), 2 Å

PDB Description: structure of the peptidylprolyl isomerase domain of the human nk- tumour recognition protein
PDB Compounds: (A:) NK-tumor recognition protein

SCOPe Domain Sequences for d2he9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2he9a1 b.62.1.1 (A:7-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqchfdieinrepvgrimfqlfsdicpktcknflclcsgekglgkttgkklcykgstfhr
vvknfmiqggdfsegngkggesiyggyfkdenfilkhdrafllsmanrgkhtngsqffit
tkpaphldgvhvvfglvisgfevieqienlktdaasrpyadvrvidcgvla

SCOPe Domain Coordinates for d2he9a1:

Click to download the PDB-style file with coordinates for d2he9a1.
(The format of our PDB-style files is described here.)

Timeline for d2he9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2he9a2