Lineage for d1dbbh1 (1dbb H:1-112)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219719Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)
  8. 219720Domain d1dbbh1: 1dbb H:1-112 [19799]
    Other proteins in same PDB: d1dbbh2, d1dbbl2
    complexed with str

Details for d1dbbh1

PDB Entry: 1dbb (more details), 2.7 Å

PDB Description: three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex

SCOP Domain Sequences for d1dbbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbbh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvs

SCOP Domain Coordinates for d1dbbh1:

Click to download the PDB-style file with coordinates for d1dbbh1.
(The format of our PDB-style files is described here.)

Timeline for d1dbbh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbbh2