SCOP 1.57: Domain d1dbbh1: 1dbb H:1-112

Lineage for d1dbbh1 (1dbb H:1-112)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab DB3 (mouse), kappa L chain [48758] (6 PDB entries)

8. Domain d1dbbh1: 1dbb H:1-112 [19799]
   Other proteins in same PDB: d1dbbh2, d1dbbl2

Details for d1dbbh1

PDB Entry: 1dbb, 2.7 Å

PDB Description: three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex

SCOP Domain Sequences for d1dbbh1:

Sequence; same for both SEQRES and ATOM records:

>d1dbbh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab DB3 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvs

Timeline for d1dbbh1:

• d1dbbh1 first appeared (with stable ids) in SCOP 1.55
  
• d1dbbh1 appears in SCOP 1.59
  
• d1dbbh1 appears in the current release, SCOPe 2.08